Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries) Uniprot Q8R3C6 399-484; 581-678 |
Domain d1whwa1: 1whw A:37-122 [114653] Other proteins in same PDB: d1whwa2, d1whwa3 Structural genomics target; 3rd RBD |
PDB Entry: 1whw (more details)
SCOPe Domain Sequences for d1whwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whwa1 d.58.7.1 (A:37-122) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} sgrlfvrnlsytsseedleklfsaygplselhypidsltkkpkgfafvtfmfpehavkay aevdgqvfqgrmlhvlpstikkeasq
Timeline for d1whwa1: