Lineage for d1whwa_ (1whw A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862051Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 862264Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)
  7. 862265Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries)
    Uniprot Q8R3C6 399-484; 581-678
  8. 862266Domain d1whwa_: 1whw A: [114653]
    Structural genomics target; 3rd RBD

Details for d1whwa_

PDB Entry: 1whw (more details)

PDB Description: solution structure of the n-terminal rna binding domain from hypothetical protein bab23448
PDB Compounds: (A:) hypothetical protein RIKEN CDNA 1200009A02

SCOP Domain Sequences for d1whwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgsgrlfvrnlsytsseedleklfsaygplselhypidsltkkpkgfafvtfmfp
ehavkayaevdgqvfqgrmlhvlpstikkeasqsgpssg

SCOP Domain Coordinates for d1whwa_:

Click to download the PDB-style file with coordinates for d1whwa_.
(The format of our PDB-style files is described here.)

Timeline for d1whwa_: