Lineage for d1we9a_ (1we9 A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067163Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1067164Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1067187Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 1067220Protein PHD finger protein At5g26210 [118328] (1 species)
  7. 1067221Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118329] (1 PDB entry)
    Uniprot O81488 201-251
  8. 1067222Domain d1we9a_: 1we9 A: [114549]
    Structural genomics target
    complexed with zn

Details for d1we9a_

PDB Entry: 1we9 (more details)

PDB Description: solution structure of phd domain in nucleic acid binding protein-like np_197993
PDB Compounds: (A:) PHD finger family protein

SCOPe Domain Sequences for d1we9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssgqcgacgesyaadefwiccdlcemwfhgkcvkitparaehikqykcpscsnksg
pssg

SCOPe Domain Coordinates for d1we9a_:

Click to download the PDB-style file with coordinates for d1we9a_.
(The format of our PDB-style files is described here.)

Timeline for d1we9a_: