| Class g: Small proteins [56992] (90 folds) |
| Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
| Family g.50.1.2: PHD domain [57911] (14 proteins) |
| Protein PHD finger protein At5g26210 [118328] (1 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118329] (1 PDB entry) Uniprot O81488 201-251 |
| Domain d1we9a_: 1we9 A: [114549] Structural genomics target complexed with zn |
PDB Entry: 1we9 (more details)
SCOPe Domain Sequences for d1we9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssgqcgacgesyaadefwiccdlcemwfhgkcvkitparaehikqykcpscsnksg
pssg
Timeline for d1we9a_: