SCOP 1.71: Domain d1we9a_: 1we9 A:

Lineage for d1we9a_ (1we9 A:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families)

5. Family g.50.1.2: PHD domain [57911] (12 proteins)

6. Protein PHD finger protein At5g26210 [118328] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118329] (1 PDB entry)

8. Domain d1we9a_: 1we9 A: [114549]
   Structural genomics target
   complexed with zn

Details for d1we9a_

PDB Entry: 1we9

PDB Description: solution structure of phd domain in nucleic acid binding protein-like np_197993

SCOP Domain Sequences for d1we9a_:

Sequence; same for both SEQRES and ATOM records:

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana)}
gssgssgqcgacgesyaadefwiccdlcemwfhgkcvkitparaehikqykcpscsnksg
pssg

Timeline for d1we9a_:

• d1we9a_ is new in SCOP 1.71
  
• d1we9a_ appears in SCOP 1.73
  
• d1we9a_ appears in the current release, SCOPe 2.08, called d1we9a1