PDB entry 1we9

View 1we9 on RCSB PDB site
Description: Solution structure of PHD domain in nucleic acid binding protein-like NP_197993
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PHD finger family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RAFL05-17-I01
    Database cross-references and differences (RAF-indexed):
    • Uniprot O81488 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.01: d1we9a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1we9A (A:)
    gssgssgqcgacgesyaadefwiccdlcemwfhgkcvkitparaehikqykcpscsnksg
    pssg