SCOPe 2.08: Domain d1we9a1: 1we9 A:8-58

Lineage for d1we9a1 (1we9 A:8-58)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein PHD finger protein At5g26210 [118328] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118329] (1 PDB entry)
   Uniprot O81488 201-251

8. Domain d1we9a1: 1we9 A:8-58 [114549]
   Other proteins in same PDB: d1we9a2, d1we9a3
   Structural genomics target
   complexed with zn

Details for d1we9a1

PDB Entry: 1we9

PDB Description: solution structure of phd domain in nucleic acid binding protein-like np_197993

PDB Compounds: (A:) PHD finger family protein

SCOPe Domain Sequences for d1we9a1:

Sequence; same for both SEQRES and ATOM records:

>d1we9a1 g.50.1.2 (A:8-58) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qcgacgesyaadefwiccdlcemwfhgkcvkitparaehikqykcpscsnk

Timeline for d1we9a1:

• d1we9a1 first appeared in SCOP 1.71, called d1we9a_
  
• d1we9a1 appears in SCOPe 2.07