Lineage for d1we9a1 (1we9 A:8-58)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2588925Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2588958Protein PHD finger protein At5g26210 [118328] (1 species)
  7. 2588959Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118329] (1 PDB entry)
    Uniprot O81488 201-251
  8. 2588960Domain d1we9a1: 1we9 A:8-58 [114549]
    Other proteins in same PDB: d1we9a2, d1we9a3
    Structural genomics target
    complexed with zn

Details for d1we9a1

PDB Entry: 1we9 (more details)

PDB Description: Solution structure of PHD domain in nucleic acid binding protein-like NP_197993
PDB Compounds: (A:) PHD finger family protein

SCOPe Domain Sequences for d1we9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we9a1 g.50.1.2 (A:8-58) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qcgacgesyaadefwiccdlcemwfhgkcvkitparaehikqykcpscsnk

SCOPe Domain Coordinates for d1we9a1:

Click to download the PDB-style file with coordinates for d1we9a1.
(The format of our PDB-style files is described here.)

Timeline for d1we9a1: