![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (14 proteins) |
![]() | Protein PHD finger protein At5g26210 [118328] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118329] (1 PDB entry) Uniprot O81488 201-251 |
![]() | Domain d1we9a1: 1we9 A:8-58 [114549] Other proteins in same PDB: d1we9a2, d1we9a3 Structural genomics target complexed with zn |
PDB Entry: 1we9 (more details)
SCOPe Domain Sequences for d1we9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we9a1 g.50.1.2 (A:8-58) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qcgacgesyaadefwiccdlcemwfhgkcvkitparaehikqykcpscsnk
Timeline for d1we9a1: