![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
![]() | Protein Pyruvate dehydrogenase E1-alpha, PdhA [117525] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [117526] (2 PDB entries) Uniprot P21873 |
![]() | Domain d1w85e_: 1w85 E: [114341] Other proteins in same PDB: d1w85b1, d1w85b2, d1w85d1, d1w85d2, d1w85f1, d1w85f2, d1w85h1, d1w85h2, d1w85i_, d1w85j_ complexed with k, mg, peg, tdp |
PDB Entry: 1w85 (more details), 2 Å
SCOPe Domain Sequences for d1w85e_:
Sequence, based on SEQRES records: (download)
>d1w85e_ c.36.1.11 (E:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfyeg infagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavyaa vkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfle akglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyke kesk
>d1w85e_ c.36.1.11 (E:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfyeg infagafkapaifvvqnnrkqtvaktlaqkavaagipgiqvdgmdplavyaavkaarera ingegptlietlcfrygphtmsgddkelenewakkdplvrfrkfleakglwseeeennvi eqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiykekesk
Timeline for d1w85e_: