PDB entry 1w85

View 1w85 on RCSB PDB site
Description: the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2
Class: oxidoreductase
Keywords: pyruvate, dehydrogenase, dihydrolipoyl, acetyl transferase, multienzyme complex, oxidoreductase, transferase
Deposited on 2004-09-16, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85a_
  • Chain 'B':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85b1, d1w85b2
  • Chain 'C':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85c_
  • Chain 'D':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85d1, d1w85d2
  • Chain 'E':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85e_
  • Chain 'F':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85f1, d1w85f2
  • Chain 'G':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85g_
  • Chain 'H':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85h1, d1w85h2
  • Chain 'I':
    Compound: dihydrolipoyllysine-residue acetyltransferase component of pyruvate
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85i_
  • Chain 'J':
    Compound: dihydrolipoyllysine-residue acetyltransferase component of pyruvate
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w85j_
  • Heterogens: MG, PEG, TDP, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w85A (A:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgd
    fyeginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w85A (A:)
    tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
    islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
    ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
    ginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavya
    avkaareraingegptlietlcfrygphtmsgdskelenewakkdplvrfrkfleakglw
    seeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiykekesk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w85B (B:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w85C (C:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgd
    fyeginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w85C (C:)
    tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
    islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
    ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
    ginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavya
    avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl
    eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk
    ekesk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w85D (D:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w85E (E:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgd
    fyeginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w85E (E:)
    fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
    slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
    hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfyeg
    infagafkapaifvvqnnrkqtvaktlaqkavaagipgiqvdgmdplavyaavkaarera
    ingegptlietlcfrygphtmsgddkelenewakkdplvrfrkfleakglwseeeennvi
    eqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiykekesk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w85F (F:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w85G (G:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgd
    fyeginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w85G (G:)
    fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
    slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
    hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfyeg
    infagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavyaa
    vkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfle
    akglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyke
    kesk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w85H (H:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w85I (I:)
    agpnrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w85I (I:)
    rviampsvrkyarekgvdirlvqgtgkngrvlkedidaflag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1w85J (J:)
    agpnrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w85J (J:)
    viampsvrkyarekgvdigtgkngrvlkedidafl