![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins) duplication: tandem repeat of this fold |
![]() | Protein Acyl-coenzyme A oxidase 1, domains 3 and 4 [116885] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116886] (1 PDB entry) Uniprot O65202 |
![]() | Domain d1w07a2: 1w07 A:462-659 [114047] Other proteins in same PDB: d1w07a3, d1w07b3 complexed with ca, cl, fad, pt |
PDB Entry: 1w07 (more details), 2 Å
SCOPe Domain Sequences for d1w07a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w07a2 a.29.3.2 (A:462-659) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ahllqcrsgvqkaedwlnpdvvleafearalrmavtcaknlskfenqeqgfqelladlve aaiahcqlivvskfiakleqdiggkgvkkqlnnlcyiyalyllhkhlgdflstncitpkq aslandqlrslytqvrpnavalvdafnytdhylnsvlgrydgnvypklfeealkdplnds vvpdgyqeylrpvlqqql
Timeline for d1w07a2: