Lineage for d1w07b3 (1w07 B:2-272)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015619Family e.6.1.2: acyl-CoA oxidase N-terminal domains [75600] (2 proteins)
  6. 3015620Protein Acyl-coenzyme A oxidase 1, domains 1 and 2 [118189] (1 species)
  7. 3015621Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118190] (1 PDB entry)
    Uniprot O65202
  8. 3015623Domain d1w07b3: 1w07 B:2-272 [114051]
    Other proteins in same PDB: d1w07a1, d1w07a2, d1w07b1, d1w07b2
    complexed with ca, cl, fad, pt

Details for d1w07b3

PDB Entry: 1w07 (more details), 2 Å

PDB Description: arabidopsis thaliana acyl-coa oxidase 1
PDB Compounds: (B:) acyl-CoA oxidase

SCOPe Domain Sequences for d1w07b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w07b3 e.6.1.2 (B:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
egidhladernkaefdvedmkivwagsrhafevsdriarlvasdpvfeksnrarlsrkel
fkstlrkcahafkriielrlneeeagrlrhfidqpayvdlhwgmfvpaikgqgteeqqkk
wlslankmqiigcyaqtelghgsnvqglettatldpktdefvihtptqtaskwwpgglgk
vsthavvyarlitngkdygihgfivqlrsledhsplpnitvgdigtkmgngaynsmdngf
lmfdhvriprdqmlmrlskvtregeyvpsdv

SCOPe Domain Coordinates for d1w07b3:

Click to download the PDB-style file with coordinates for d1w07b3.
(The format of our PDB-style files is described here.)

Timeline for d1w07b3: