![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.2: acyl-CoA oxidase N-terminal domains [75600] (2 proteins) |
![]() | Protein Acyl-coenzyme A oxidase 1, domains 1 and 2 [118189] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118190] (1 PDB entry) Uniprot O65202 |
![]() | Domain d1w07b3: 1w07 B:2-272 [114051] Other proteins in same PDB: d1w07a1, d1w07a2, d1w07b1, d1w07b2 complexed with ca, cl, fad, pt |
PDB Entry: 1w07 (more details), 2 Å
SCOPe Domain Sequences for d1w07b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w07b3 e.6.1.2 (B:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} egidhladernkaefdvedmkivwagsrhafevsdriarlvasdpvfeksnrarlsrkel fkstlrkcahafkriielrlneeeagrlrhfidqpayvdlhwgmfvpaikgqgteeqqkk wlslankmqiigcyaqtelghgsnvqglettatldpktdefvihtptqtaskwwpgglgk vsthavvyarlitngkdygihgfivqlrsledhsplpnitvgdigtkmgngaynsmdngf lmfdhvriprdqmlmrlskvtregeyvpsdv
Timeline for d1w07b3: