Lineage for d1w07b1 (1w07 B:273-461)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992885Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1993004Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 protein domains)
    duplication: tandem repeat of this fold
  6. 1993005Protein Acyl-coenzyme A oxidase 1, domains 3 and 4 [116885] (1 species)
  7. 1993006Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116886] (1 PDB entry)
    Uniprot O65202
  8. 1993009Domain d1w07b1: 1w07 B:273-461 [114049]
    Other proteins in same PDB: d1w07a3, d1w07b3
    complexed with ca, cl, fad, pt

Details for d1w07b1

PDB Entry: 1w07 (more details), 2 Å

PDB Description: arabidopsis thaliana acyl-coa oxidase 1
PDB Compounds: (B:) acyl-CoA oxidase

SCOPe Domain Sequences for d1w07b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w07b1 a.29.3.2 (B:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkqlvygtmvyvrqtivadasnalsravciatrysavrrqfgahnggietqvidyktqqn
rlfpllasayafrfvgewlkwlytdvterlaasdfatlpeahactaglksltttatadgi
eecrklcgghgylwcsglpelfavyvpactyegdnvvlqlqvarflmktvaqlgsgkvpv
gttaymgra

SCOPe Domain Coordinates for d1w07b1:

Click to download the PDB-style file with coordinates for d1w07b1.
(The format of our PDB-style files is described here.)

Timeline for d1w07b1: