Lineage for d1w07a1 (1w07 A:273-461)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708463Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins)
    duplication: tandem repeat of this fold
  6. 2708464Protein Acyl-coenzyme A oxidase 1, domains 3 and 4 [116885] (1 species)
  7. 2708465Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116886] (1 PDB entry)
    Uniprot O65202
  8. 2708466Domain d1w07a1: 1w07 A:273-461 [114046]
    Other proteins in same PDB: d1w07a3, d1w07b3
    complexed with ca, cl, fad, pt

Details for d1w07a1

PDB Entry: 1w07 (more details), 2 Å

PDB Description: arabidopsis thaliana acyl-coa oxidase 1
PDB Compounds: (A:) acyl-CoA oxidase

SCOPe Domain Sequences for d1w07a1:

Sequence, based on SEQRES records: (download)

>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkqlvygtmvyvrqtivadasnalsravciatrysavrrqfgahnggietqvidyktqqn
rlfpllasayafrfvgewlkwlytdvterlaasdfatlpeahactaglksltttatadgi
eecrklcgghgylwcsglpelfavyvpactyegdnvvlqlqvarflmktvaqlgsgkvpv
gttaymgra

Sequence, based on observed residues (ATOM records): (download)

>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkqlvygtmvyvrqtivadasnalsravciatrysavrrqfgagietqvidyktqqnrlf
pllasayafrfvgewlkwlytdvterlaasdfatlpeahactaglksltttatadgieec
rklcgghgylwcsglpelfavyvpactyegdnvvlqlqvarflmktvaqlgsgkvpvgtt
aymgra

SCOPe Domain Coordinates for d1w07a1:

Click to download the PDB-style file with coordinates for d1w07a1.
(The format of our PDB-style files is described here.)

Timeline for d1w07a1: