SCOPe 2.08: Domain d1vzya2: 1vzy A:234-290

Lineage for d1vzya2 (1vzy A:234-290)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.81: HSP33 redox switch-like [118351] (1 superfamily)
   alpha+beta zinc-binding domain; alpha(2)-beta(2)-alpha

4. Superfamily g.81.1: HSP33 redox switch-like [118352] (1 family)

5. Family g.81.1.1: HSP33 redox switch-like [118353] (1 protein)

6. Protein HSP33, C-terminal domain [118354] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [118356] (1 PDB entry)
   Uniprot P37565

8. Domain d1vzya2: 1vzy A:234-290 [114043]
   Other proteins in same PDB: d1vzya1, d1vzyb1
   complexed with act, zn

Details for d1vzya2

PDB Entry: 1vzy, 1.97 Å

PDB Description: crystal structure of the bacillus subtilis hsp33

PDB Compounds: (A:) 33 kda chaperonin

SCOPe Domain Sequences for d1vzya2:

Sequence; same for both SEQRES and ATOM records:

>d1vzya2 g.81.1.1 (A:234-290) HSP33, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
hcpcskerfetailglgkkeiqdmieedgqaeavchfcnekylftkeeleglrdqtt

Timeline for d1vzya2:

• d1vzya2 first appeared in SCOP 1.71
  
• d1vzya2 appears in SCOPe 2.07