Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.193: Hsp33 domain [64396] (1 superfamily) 3 layers: beta/alpha/beta; buried helix |
Superfamily d.193.1: Hsp33 domain [64397] (1 family) automatically mapped to Pfam PF01430 |
Family d.193.1.1: Hsp33 domain [64398] (2 proteins) forms strand-swapped dimer |
Protein Heat shock protein 33, Hsp33 [64399] (3 species) |
Species Bacillus subtilis [TaxId:1423] [118113] (1 PDB entry) Uniprot P37565 |
Domain d1vzya1: 1vzy A:1-233 [114042] Other proteins in same PDB: d1vzya2, d1vzyb2 complexed with act, zn |
PDB Entry: 1vzy (more details), 1.97 Å
SCOPe Domain Sequences for d1vzya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzya1 d.193.1.1 (A:1-233) Heat shock protein 33, Hsp33 {Bacillus subtilis [TaxId: 1423]} mdylvkalaydgkvrayaarttdmvnegqrrhgtwptasaalgrtmtaslmlgamlkgdd kltvkiegggpigaivadanakgevrayvsnpqvhfdlnaagkldvrravgtngtlsvvk dlglrefftgqveivsgelgddftyylvsseqvpssvgvgvlvnpdntilaaggfiiqlm pgtddetitkieqrlsqvepiskliqkgltpeeileevlgekpeiletmpvrf
Timeline for d1vzya1: