Lineage for d1vzya1 (1vzy A:1-233)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615680Fold d.193: Hsp33 domain [64396] (1 superfamily)
    3 layers: beta/alpha/beta; buried helix
  4. 615681Superfamily d.193.1: Hsp33 domain [64397] (1 family) (S)
  5. 615682Family d.193.1.1: Hsp33 domain [64398] (1 protein)
    forms strand-swapped dimer
  6. 615683Protein Heat shock protein 33, Hsp33 [64399] (3 species)
  7. 615684Species Bacillus subtilis [TaxId:1423] [118113] (1 PDB entry)
  8. 615685Domain d1vzya1: 1vzy A:1-233 [114042]
    Other proteins in same PDB: d1vzya2, d1vzyb2

Details for d1vzya1

PDB Entry: 1vzy (more details), 1.97 Å

PDB Description: crystal structure of the bacillus subtilis hsp33

SCOP Domain Sequences for d1vzya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzya1 d.193.1.1 (A:1-233) Heat shock protein 33, Hsp33 {Bacillus subtilis}
mdylvkalaydgkvrayaarttdmvnegqrrhgtwptasaalgrtmtaslmlgamlkgdd
kltvkiegggpigaivadanakgevrayvsnpqvhfdlnaagkldvrravgtngtlsvvk
dlglrefftgqveivsgelgddftyylvsseqvpssvgvgvlvnpdntilaaggfiiqlm
pgtddetitkieqrlsqvepiskliqkgltpeeileevlgekpeiletmpvrf

SCOP Domain Coordinates for d1vzya1:

Click to download the PDB-style file with coordinates for d1vzya1.
(The format of our PDB-style files is described here.)

Timeline for d1vzya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzya2