PDB entry 1vzy

View 1vzy on RCSB PDB site
Description: crystal structure of the bacillus subtilis hsp33
Class: chaperone
Keywords: chaperone, heat shock protein, crystal engineering, molecular chaperone, redox-active center, psi, protein structure initiative, mcsg, midwest center for structural genomics
Deposited on 2004-05-29, released 2004-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 33 kda chaperonin
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37565 (0-End)
      • engineered mutation (99-100)
    Domains in SCOPe 2.07: d1vzya1, d1vzya2
  • Chain 'B':
    Compound: 33 kda chaperonin
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37565 (0-End)
      • engineered mutation (99-100)
    Domains in SCOPe 2.07: d1vzyb1, d1vzyb2
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzyA (A:)
    mdylvkalaydgkvrayaarttdmvnegqrrhgtwptasaalgrtmtaslmlgamlkgdd
    kltvkiegggpigaivadanakgevrayvsnpqvhfdlnaagkldvrravgtngtlsvvk
    dlglrefftgqveivsgelgddftyylvsseqvpssvgvgvlvnpdntilaaggfiiqlm
    pgtddetitkieqrlsqvepiskliqkgltpeeileevlgekpeiletmpvrfhcpcske
    rfetailglgkkeiqdmieedgqaeavchfcnekylftkeeleglrdqttr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzyA (A:)
    mdylvkalaydgkvrayaarttdmvnegqrrhgtwptasaalgrtmtaslmlgamlkgdd
    kltvkiegggpigaivadanakgevrayvsnpqvhfdlnaagkldvrravgtngtlsvvk
    dlglrefftgqveivsgelgddftyylvsseqvpssvgvgvlvnpdntilaaggfiiqlm
    pgtddetitkieqrlsqvepiskliqkgltpeeileevlgekpeiletmpvrfhcpcske
    rfetailglgkkeiqdmieedgqaeavchfcnekylftkeeleglrdqtt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vzyB (B:)
    mdylvkalaydgkvrayaarttdmvnegqrrhgtwptasaalgrtmtaslmlgamlkgdd
    kltvkiegggpigaivadanakgevrayvsnpqvhfdlnaagkldvrravgtngtlsvvk
    dlglrefftgqveivsgelgddftyylvsseqvpssvgvgvlvnpdntilaaggfiiqlm
    pgtddetitkieqrlsqvepiskliqkgltpeeileevlgekpeiletmpvrfhcpcske
    rfetailglgkkeiqdmieedgqaeavchfcnekylftkeeleglrdqttr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzyB (B:)
    mdylvkalaydgkvrayaarttdmvnegqrrhgtwptasaalgrtmtaslmlgamlkgdd
    kltvkiegggpigaivadanakgevrayvsnpqvhfdlnaagkldvrravgtngtlsvvk
    dlglrefftgqveivsgelgddftyylvsseqvpssvgvgvlvnpdntilaaggfiiqlm
    pgtddetitkieqrlsqvepiskliqkgltpeeileevlgekpeiletmpvrfhcpcske
    rfetailglgkkeiqdmieedgqaeavchfcnekylftkeeleglr