Lineage for d1vzyb1 (1vzy B:1-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005820Fold d.193: Hsp33 domain [64396] (1 superfamily)
    3 layers: beta/alpha/beta; buried helix
  4. 3005821Superfamily d.193.1: Hsp33 domain [64397] (1 family) (S)
    automatically mapped to Pfam PF01430
  5. 3005822Family d.193.1.1: Hsp33 domain [64398] (2 proteins)
    forms strand-swapped dimer
  6. 3005823Protein Heat shock protein 33, Hsp33 [64399] (3 species)
  7. 3005824Species Bacillus subtilis [TaxId:1423] [118113] (1 PDB entry)
    Uniprot P37565
  8. 3005826Domain d1vzyb1: 1vzy B:1-233 [114044]
    Other proteins in same PDB: d1vzya2, d1vzyb2
    complexed with act, zn

Details for d1vzyb1

PDB Entry: 1vzy (more details), 1.97 Å

PDB Description: crystal structure of the bacillus subtilis hsp33
PDB Compounds: (B:) 33 kda chaperonin

SCOPe Domain Sequences for d1vzyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzyb1 d.193.1.1 (B:1-233) Heat shock protein 33, Hsp33 {Bacillus subtilis [TaxId: 1423]}
mdylvkalaydgkvrayaarttdmvnegqrrhgtwptasaalgrtmtaslmlgamlkgdd
kltvkiegggpigaivadanakgevrayvsnpqvhfdlnaagkldvrravgtngtlsvvk
dlglrefftgqveivsgelgddftyylvsseqvpssvgvgvlvnpdntilaaggfiiqlm
pgtddetitkieqrlsqvepiskliqkgltpeeileevlgekpeiletmpvrf

SCOPe Domain Coordinates for d1vzyb1:

Click to download the PDB-style file with coordinates for d1vzyb1.
(The format of our PDB-style files is described here.)

Timeline for d1vzyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzyb2