Lineage for d1vpka1 (1vpk A:1-120)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040996Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1040997Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1040998Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 1040999Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 1041058Species Thermotoga maritima [TaxId:2336] [118108] (1 PDB entry)
    Uniprot Q9WYA0
  8. 1041059Domain d1vpka1: 1vpk A:1-120 [113963]
    Structural genomics target

Details for d1vpka1

PDB Entry: 1vpk (more details), 2 Å

PDB Description: Crystal structure of DNA polymerase III, beta subunit (TM0262) from Thermotoga maritima at 2.00 A resolution
PDB Compounds: (A:) DNA polymerase III, beta subunit

SCOPe Domain Sequences for d1vpka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpka1 d.131.1.1 (A:1-120) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]}
mkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatdletgvkatvnaa
eisgearfvvpgdviqkmvkvlpdeitelslegdalvissgstvfrittmpadefpeitp

SCOPe Domain Coordinates for d1vpka1:

Click to download the PDB-style file with coordinates for d1vpka1.
(The format of our PDB-style files is described here.)

Timeline for d1vpka1: