Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) |
Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
Protein DNA polymerase III, beta subunit [55981] (2 species) |
Species Thermotoga maritima [TaxId:2336] [118108] (1 PDB entry) Uniprot Q9WYA0 |
Domain d1vpka3: 1vpk A:244-366 [113965] Structural genomics target |
PDB Entry: 1vpk (more details), 2 Å
SCOPe Domain Sequences for d1vpka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpka3 d.131.1.1 (A:244-366) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]} krvipetfktkvvvsrkelreslkrvmviaskgsesvkfeieenvmrlvskspdygevvd evevqkegedlviafnpkfiedvlkhieteeiemnfvdstspcqinpldisgylyivmpi rla
Timeline for d1vpka3: