| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
| Protein DNA polymerase III, beta subunit [55981] (2 species) |
| Species Thermotoga maritima [TaxId:2336] [118108] (1 PDB entry) Uniprot Q9WYA0 |
| Domain d1vpka1: 1vpk A:1-120 [113963] Other proteins in same PDB: d1vpka4 Structural genomics target |
PDB Entry: 1vpk (more details), 2 Å
SCOPe Domain Sequences for d1vpka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpka1 d.131.1.1 (A:1-120) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]}
mkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatdletgvkatvnaa
eisgearfvvpgdviqkmvkvlpdeitelslegdalvissgstvfrittmpadefpeitp
Timeline for d1vpka1: