Lineage for d1u8vc1 (1u8v C:276-490)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992885Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1992886Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 protein domains)
  6. 1992887Protein 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal domain [116883] (1 species)
  7. 1992888Species Clostridium aminobutyricum [TaxId:33953] [116884] (1 PDB entry)
    Uniprot P55792
  8. 1992891Domain d1u8vc1: 1u8v C:276-490 [113200]
    Other proteins in same PDB: d1u8va2, d1u8vb2, d1u8vc2, d1u8vd2
    complexed with fad, sf4

Details for d1u8vc1

PDB Entry: 1u8v (more details), 1.6 Å

PDB Description: Crystal Structure of 4-Hydroxybutyryl-CoA Dehydratase from Clostridium aminobutyricum: Radical catalysis involving a [4Fe-4S] cluster and flavin
PDB Compounds: (C:) Gamma-aminobutyrate metabolism dehydratase/isomerase

SCOPe Domain Sequences for d1u8vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8vc1 a.29.3.1 (C:276-490) 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal domain {Clostridium aminobutyricum [TaxId: 33953]}
qeydfagmmverfagyhrqsyggckvgvgdvvigaaalaadyngaqkashvkdkliemth
lnetlyccgiacsaegyptaagnyqidlllanvckqnitrfpyeivrlaediagglmvtm
pseadfksetvvgrdgetigdfcnkffaaaptctteermrvlrfleniclgasavgyrte
smhgagspqaqrimiarqgninakkelakaiagik

SCOPe Domain Coordinates for d1u8vc1:

Click to download the PDB-style file with coordinates for d1u8vc1.
(The format of our PDB-style files is described here.)

Timeline for d1u8vc1: