Lineage for d1u8vb2 (1u8v B:1-275)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570414Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 2570415Protein 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains [118187] (1 species)
  7. 2570416Species Clostridium aminobutyricum [TaxId:33953] [118188] (1 PDB entry)
    Uniprot P55792
  8. 2570418Domain d1u8vb2: 1u8v B:1-275 [113199]
    Other proteins in same PDB: d1u8va1, d1u8vb1, d1u8vc1, d1u8vd1
    complexed with fad, sf4

Details for d1u8vb2

PDB Entry: 1u8v (more details), 1.6 Å

PDB Description: crystal structure of 4-hydroxybutyryl-coa dehydratase from clostridium aminobutyricum: radical catalysis involving a [4fe-4s] cluster and flavin
PDB Compounds: (B:) Gamma-aminobutyrate metabolism dehydratase/isomerase

SCOPe Domain Sequences for d1u8vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8vb2 e.6.1.1 (B:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]}
mlmtaeqyieslrklntrvymfgekienwvdhpmirpsincvrmtyelaqdpqyadlmtt
ksnligktinrfanlhqstddlrkkvkmqrllgqktascfqrcvgmdafnavfsttyeid
qkygtnyhknfteylkyiqendlivdgamtdpkgdrglapsaqkdpdlflrivekredgi
vvrgakahqtgsinshehiimptiamteadkdyavsfacpsdadglfmiygrqscdtrkm
eegadidlgnkqfggqealvvfdnvfipndriflc

SCOPe Domain Coordinates for d1u8vb2:

Click to download the PDB-style file with coordinates for d1u8vb2.
(The format of our PDB-style files is described here.)

Timeline for d1u8vb2: