Lineage for d1u8ca3 (1u8c A:738-956)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032015Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2032016Family b.1.15.1: Integrin domains [69180] (2 protein domains)
  6. 2032030Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 2032031Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
    Uniprot P06756 31-986
  8. 2032043Domain d1u8ca3: 1u8c A:738-956 [113118]
    Other proteins in same PDB: d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag, ndg

Details for d1u8ca3

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: A novel adaptation of the integrin PSI domain revealed from its crystal structure
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d1u8ca3:

Sequence, based on SEQRES records: (download)

>d1u8ca3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwgiq

Sequence, based on observed residues (ATOM records): (download)

>d1u8ca3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikissldihtlgcgvaqclkivcqv
grldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstl
vttnvtwgiq

SCOPe Domain Coordinates for d1u8ca3:

Click to download the PDB-style file with coordinates for d1u8ca3.
(The format of our PDB-style files is described here.)

Timeline for d1u8ca3: