Lineage for d1u8cb6 (1u8c B:1001-1057)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033514Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 3033549Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 3033550Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 3033556Protein Integrin beta-3 [118249] (1 species)
  7. 3033557Species Human (Homo sapiens) [TaxId:9606] [118250] (6 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 3033565Domain d1u8cb6: 1u8c B:1001-1057 [113125]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5
    complexed with ca, nag

Details for d1u8cb6

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1u8cb6:

Sequence, based on SEQRES records: (download)

>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

Sequence, based on observed residues (ATOM records): (download)

>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncaiefp

SCOPe Domain Coordinates for d1u8cb6:

Click to download the PDB-style file with coordinates for d1u8cb6.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb6: