![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
![]() | Superfamily g.16.2: Plexin repeat [103575] (1 family) ![]() |
![]() | Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
![]() | Protein Integrin beta-3 [118249] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118250] (6 PDB entries) Uniprot P05106 27-716 ! Uniprot P05106 27-466 |
![]() | Domain d1u8cb6: 1u8c B:1001-1057 [113125] Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5 complexed with ca, nag |
PDB Entry: 1u8c (more details), 3.1 Å
SCOPe Domain Sequences for d1u8cb6:
Sequence, based on SEQRES records: (download)
>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp
>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens) [TaxId: 9606]} gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncaiefp
Timeline for d1u8cb6: