![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.15: Integrin domains [69179] (2 families) ![]() |
![]() | Family b.1.15.1: Integrin domains [69180] (2 proteins) |
![]() | Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries) Uniprot P06756 31-986 |
![]() | Domain d1u8ca1: 1u8c A:439-598 [113116] Other proteins in same PDB: d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6 complexed with ca, nag |
PDB Entry: 1u8c (more details), 3.1 Å
SCOPe Domain Sequences for d1u8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8ca1 b.1.15.1 (A:439-598) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahilldcge
Timeline for d1u8ca1: