PDB entry 1u8c

View 1u8c on RCSB PDB site
Description: A novel adaptation of the integrin PSI domain revealed from its crystal structure
Class: cell adhesion
Keywords: PSI domain, integrin, vitronectrin receptor, CELL ADHESION
Deposited on 2004-08-05, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.293
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8cA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikisslqt
    tekndtvagqgerdhlitkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvk
    sllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlvttnvtwgiqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8cA (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldcgedn
    vckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvrnn
    ealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiqss
    nlfdkvspvvshkvdlavlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiy
    elrnngpssfskamlhlqwpykynnntllyilhydidgpmnctsdmeinplrikissldi
    htlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhsyslkssasfnvi
    efpyknlpieditnstlvttnvtwgiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u8cB (B:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaqaepnshrcnngngtfecgvcrcgpgwlgsqcecseedyrp
    sqqdecspregqpvcsqrgeclcgqcvchssdfgkitgkycecddfscvrykgemcsghg
    qcscgdclcdsdwtgyycncttrtdtcmssngllcsgrgkcecgscvciqpgsygdtcek
    cptcpdactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykne
    ddcvvrfqyyedssgksilyvveepecpkgpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8cB (B:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncaiefpvsearv
    ledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdlsys
    mkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydmktt
    clpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrndas
    hllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmteklsqkn
    inlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevrdlp
    eelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkd
    slivqvtfdcdcddfscvrykgemcsghgqcscgdclcdsdwtgyycncttrtdtcmssn
    gllcsgrgkcecgscvciqpgsygdtcekcptcpdactfkkecveckkfdrepymtentc
    nrycrdeiesvkelkdtgkdavnctykneddcvvrfqyyedssgksilyvveepecpkg