Lineage for d1u8ca3 (1u8c A:738-956)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551936Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 551937Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 551952Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 551953Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
  8. 551965Domain d1u8ca3: 1u8c A:738-956 [113118]
    Other proteins in same PDB: d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag

Details for d1u8ca3

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure

SCOP Domain Sequences for d1u8ca3:

Sequence, based on SEQRES records: (download)

>d1u8ca3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwgiq

Sequence, based on observed residues (ATOM records): (download)

>d1u8ca3 b.1.15.1 (A:738-956) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikissldihtlgcgvaqclkivcqv
grldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstl
vttnvtwgiq

SCOP Domain Coordinates for d1u8ca3:

Click to download the PDB-style file with coordinates for d1u8ca3.
(The format of our PDB-style files is described here.)

Timeline for d1u8ca3: