Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (1 family) |
Family b.1.15.1: Integrin domains [69180] (2 proteins) |
Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries) |
Domain d1u8ca1: 1u8c A:439-598 [113116] Other proteins in same PDB: d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6 |
PDB Entry: 1u8c (more details), 3.1 Å
SCOP Domain Sequences for d1u8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8ca1 b.1.15.1 (A:439-598) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens)} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahilldcge
Timeline for d1u8ca1: