Lineage for d1u8cb1 (1u8c B:1058-1106,B:1355-1434)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551936Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 551937Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 551938Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 551939Species Human (Homo sapiens) [TaxId:9606] [69184] (10 PDB entries)
  8. 551951Domain d1u8cb1: 1u8c B:1058-1106,B:1355-1434 [113120]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag

Details for d1u8cb1

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: A novel adaptation of the integrin PSI domain revealed from its crystal structure

SCOP Domain Sequences for d1u8cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8cb1 b.1.15.1 (B:1058-1106,B:1355-1434) Hybrid domain of integrin beta {Human (Homo sapiens)}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcd

SCOP Domain Coordinates for d1u8cb1:

Click to download the PDB-style file with coordinates for d1u8cb1.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb1: