Lineage for d1u8cb6 (1u8c B:1001-1057)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623301Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 623330Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 623331Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam 01437
  6. 623336Protein Integrin beta-3 [118249] (1 species)
  7. 623337Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries)
  8. 623346Domain d1u8cb6: 1u8c B:1001-1057 [113125]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5
    complexed with ca, nag

Details for d1u8cb6

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure

SCOP Domain Sequences for d1u8cb6:

Sequence, based on SEQRES records: (download)

>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens)}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

Sequence, based on observed residues (ATOM records): (download)

>d1u8cb6 g.16.2.1 (B:1001-1057) Integrin beta-3 {Human (Homo sapiens)}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncaiefp

SCOP Domain Coordinates for d1u8cb6:

Click to download the PDB-style file with coordinates for d1u8cb6.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb6: