Lineage for d1u5oa_ (1u5o A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936311Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 2936333Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)
  7. 2936348Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries)
    Uniprot P61972
  8. 2936369Domain d1u5oa_: 1u5o A: [113044]
    mutant

Details for d1u5oa_

PDB Entry: 1u5o (more details), 2.5 Å

PDB Description: structure of the d23a mutant of the nuclear transport carrier ntf2
PDB Compounds: (A:) nuclear transport factor 2

SCOPe Domain Sequences for d1u5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5oa_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdkpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslpf
qkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
alhnf

SCOPe Domain Coordinates for d1u5oa_:

Click to download the PDB-style file with coordinates for d1u5oa_.
(The format of our PDB-style files is described here.)

Timeline for d1u5oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u5ob_