SCOPe 2.08: Domain d1u5ob_: 1u5o B:

Lineage for d1u5ob_ (1u5o B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries)
   Uniprot P61972

8. Domain d1u5ob_: 1u5o B: [113045]
   mutant

Details for d1u5ob_

PDB Entry: 1u5o, 2.5 Å

PDB Description: structure of the d23a mutant of the nuclear transport carrier ntf2

PDB Compounds: (B:) nuclear transport factor 2

SCOPe Domain Sequences for d1u5ob_:

Sequence; same for both SEQRES and ATOM records:

>d1u5ob_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
h

Timeline for d1u5ob_:

• d1u5ob_ first appeared in SCOP 1.71
  
• d1u5ob_ appears in SCOPe 2.07