PDB entry 1u5o

View 1u5o on RCSB PDB site
Description: Structure of the D23A mutant of the nuclear transport carrier NTF2
Class: protein transport
Keywords: transport, nuclear transport protein, NTF2 mutant D23A, PROTEIN TRANSPORT
Deposited on 2004-07-28, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear transport factor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nutf2, Ntf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61972
      • engineered (22)
    Domains in SCOPe 2.07: d1u5oa_
  • Chain 'B':
    Compound: nuclear transport factor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nutf2, Ntf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61972
      • engineered (22)
    Domains in SCOPe 2.07: d1u5ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5oA (A:)
    mgdkpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslp
    fqkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfr
    lalhnfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5oA (A:)
    gdkpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslpf
    qkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
    alhnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u5oB (B:)
    mgdkpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslp
    fqkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfr
    lalhnfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5oB (B:)
    kpiweqigssfiqhyyqlfandrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
    iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
    h