Lineage for d1u00a1 (1u00 A:504-615)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985633Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1985814Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 1985815Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 protein domains)
  6. 1985816Protein Chaperone protein hscA (Hsc66) [116852] (1 species)
  7. 1985817Species Escherichia coli [TaxId:562] [116853] (1 PDB entry)
    Uniprot P0A6Z1 390-615
  8. 1985818Domain d1u00a1: 1u00 A:504-615 [112900]
    Other proteins in same PDB: d1u00a2

Details for d1u00a1

PDB Entry: 1u00 (more details), 1.95 Å

PDB Description: hsca substrate binding domain complexed with the iscu recognition peptide elppvkihc
PDB Compounds: (A:) Chaperone protein hscA

SCOPe Domain Sequences for d1u00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]}
ltdseiasmikdsmsyaeqdvkarmlaeqkveaarvleslhgalaadaallsaaerqvid
daaahlsevaqgddvdaieqaiknvdkqtqdfaarrmdqsvrralkghsvde

SCOPe Domain Coordinates for d1u00a1:

Click to download the PDB-style file with coordinates for d1u00a1.
(The format of our PDB-style files is described here.)

Timeline for d1u00a1: