PDB entry 1u00

View 1u00 on RCSB PDB site
Description: HscA substrate binding domain complexed with the IscU recognition peptide ELPPVKIHC
Class: chaperone
Keywords: HscA, Hsc66, DnaK, Hsp70, IscU, CHAPERONE
Deposited on 2004-07-12, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein hscA
    Species: Escherichia coli [TaxId:562]
    Gene: hscA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Z1 (0-226)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1u00a1, d1u00a2
  • Chain 'P':
    Compound: IscU recognition peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1U00 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u00A (A:)
    mdviplslgletmgglvekviprnttipvaraqdfttfkdgqtamsihvmqgerelvqdc
    rslarfalrgipalpaggahirvtfqvdadgllsvtamekstgveasiqvkpsygltdse
    iasmikdsmsyaeqdvkarmlaeqkveaarvleslhgalaadaallsaaerqviddaaah
    lsevaqgddvdaieqaiknvdkqtqdfaarrmdqsvrralkghsvde
    

  • Chain 'P':
    No sequence available.