SCOP 1.71: Domain d1u00a1: 1u00 A:504-615

Lineage for d1u00a1 (1u00 A:504-615)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (8 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (2 proteins)

6. Protein Chaperone protein hscA (Hsc66) [116852] (1 species)

7. Species Escherichia coli [TaxId:562] [116853] (1 PDB entry)

8. Domain d1u00a1: 1u00 A:504-615 [112900]
   Other proteins in same PDB: d1u00a2

Details for d1u00a1

PDB Entry: 1u00, 1.95 Å

PDB Description: hsca substrate binding domain complexed with the iscu recognition peptide elppvkihc

SCOP Domain Sequences for d1u00a1:

Sequence; same for both SEQRES and ATOM records:

>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli}
ltdseiasmikdsmsyaeqdvkarmlaeqkveaarvleslhgalaadaallsaaerqvid
daaahlsevaqgddvdaieqaiknvdkqtqdfaarrmdqsvrralkghsvde

Timeline for d1u00a1:

• d1u00a1 is new in SCOP 1.71
  
• d1u00a1 appears in SCOP 1.73
  
• d1u00a1 appears in the current release, SCOPe 2.08