Lineage for d1u00a2 (1u00 A:389-503)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824537Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 2824538Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 2824539Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 2824540Protein Chaperone protein hscA (Hsc66) [117097] (1 species)
  7. 2824541Species Escherichia coli [TaxId:562] [117098] (1 PDB entry)
    Uniprot P0A6Z1 390-615
  8. 2824542Domain d1u00a2: 1u00 A:389-503 [112901]
    Other proteins in same PDB: d1u00a1

Details for d1u00a2

PDB Entry: 1u00 (more details), 1.95 Å

PDB Description: hsca substrate binding domain complexed with the iscu recognition peptide elppvkihc
PDB Compounds: (A:) Chaperone protein hscA

SCOPe Domain Sequences for d1u00a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]}
mdviplslgletmgglvekviprnttipvaraqdfttfkdgqtamsihvmqgerelvqdc
rslarfalrgipalpaggahirvtfqvdadgllsvtamekstgveasiqvkpsyg

SCOPe Domain Coordinates for d1u00a2:

Click to download the PDB-style file with coordinates for d1u00a2.
(The format of our PDB-style files is described here.)

Timeline for d1u00a2: