![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Onchocerca volvulus [TaxId:6282] [116911] (2 PDB entries) Uniprot P46427 |
![]() | Domain d1tu8b1: 1tu8 B:78-208 [112659] Other proteins in same PDB: d1tu8a2, d1tu8b2, d1tu8c2, d1tu8d2 complexed with gtx |
PDB Entry: 1tu8 (more details), 1.8 Å
SCOPe Domain Sequences for d1tu8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu8b1 a.45.1.1 (B:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} genemettyidmfcegvrdlhvkytrmiymayetekdpyiksilpgelakfekllatrgn grnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhqrmkdrpklkeycekrda akvpvngngkq
Timeline for d1tu8b1: