| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class pi GST [81358] (4 species) |
| Species Onchocerca volvulus [TaxId:6282] [117595] (2 PDB entries) Uniprot P46427 |
| Domain d1tu8a2: 1tu8 A:1-77 [112658] Other proteins in same PDB: d1tu8a1, d1tu8b1, d1tu8c1, d1tu8d1 complexed with gtx |
PDB Entry: 1tu8 (more details), 1.8 Å
SCOPe Domain Sequences for d1tu8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu8a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
msykltyfsirglaepirlflvdqdikfiddriakddfssiksqfqfgqlpclydgdqqi
vqsgailrhlarkynln
Timeline for d1tu8a2: