SCOPe 2.08: Domain d1tu8a1: 1tu8 A:78-208

Lineage for d1tu8a1 (1tu8 A:78-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Onchocerca volvulus [TaxId:6282] [116911] (2 PDB entries)
   Uniprot P46427

8. Domain d1tu8a1: 1tu8 A:78-208 [112657]
   Other proteins in same PDB: d1tu8a2, d1tu8b2, d1tu8c2, d1tu8d2
   complexed with gtx

Details for d1tu8a1

PDB Entry: 1tu8, 1.8 Å

PDB Description: structure of onchoverca volvulus pi-class glutathione s-transferase with its kompetitive inhibitor s-hexyl-gsh

PDB Compounds: (A:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tu8a1:

Sequence; same for both SEQRES and ATOM records:

>d1tu8a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
genemettyidmfcegvrdlhvkytrmiymayetekdpyiksilpgelakfekllatrgn
grnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhqrmkdrpklkeycekrda
akvpvngngkq

Timeline for d1tu8a1:

• d1tu8a1 first appeared in SCOP 1.71
  
• d1tu8a1 appears in SCOPe 2.07