SCOPe 2.08: Domain d1t9dc3: 1t9d C:461-687

Lineage for d1t9dc3 (1t9d C:461-687)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (8 PDB entries)
   Uniprot P07342 84-687

8. Domain d1t9dc3: 1t9d C:461-687 [112354]
   Other proteins in same PDB: d1t9da1, d1t9da2, d1t9db1, d1t9db2, d1t9dc1, d1t9dc2, d1t9dd1, d1t9dd2
   complexed with 1mm, fad, k, mg, p22, p25, pyd

Details for d1t9dc3

PDB Entry: 1t9d, 2.3 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl

PDB Compounds: (C:) Acetolactate synthase, mitochondrial

SCOPe Domain Sequences for d1t9dc3:

Sequence; same for both SEQRES and ATOM records:

>d1t9dc3 c.36.1.9 (C:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh

Timeline for d1t9dc3:

• d1t9dc3 first appeared in SCOP 1.71
  
• d1t9dc3 appears in SCOPe 2.07