| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Acetohydroxyacid synthase catalytic subunit [88758] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (6 PDB entries) |
| Domain d1t9dc3: 1t9d C:461-687 [112354] Other proteins in same PDB: d1t9da1, d1t9da2, d1t9db1, d1t9db2, d1t9dc1, d1t9dc2, d1t9dd1, d1t9dd2 |
PDB Entry: 1t9d (more details), 2.3 Å
SCOP Domain Sequences for d1t9dc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9dc3 c.36.1.9 (C:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
Timeline for d1t9dc3: