Lineage for d1t0fb1 (1t0f B:169-268)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982908Family a.4.5.27: TnsA endonuclease, C-terminal domain [46782] (1 protein)
    automatically mapped to Pfam PF08721
  6. 1982909Protein TnsA endonuclease, C-terminal domain [46783] (1 species)
  7. 1982910Species Escherichia coli [TaxId:562] [46784] (2 PDB entries)
    Uniprot P13988
  8. 1982912Domain d1t0fb1: 1t0f B:169-268 [112197]
    Other proteins in same PDB: d1t0fa2, d1t0fb2
    complexed with the transposition protein TnsC peptide (Uniprot P05846 505-553), chains C and D
    protein/DNA complex; complexed with mg, mla, mpd

Details for d1t0fb1

PDB Entry: 1t0f (more details), 1.85 Å

PDB Description: crystal structure of the tnsa/tnsc(504-555) complex
PDB Compounds: (B:) Transposon Tn7 transposition protein tnsA

SCOPe Domain Sequences for d1t0fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0fb1 a.4.5.27 (B:169-268) TnsA endonuclease, C-terminal domain {Escherichia coli [TaxId: 562]}
npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt
lseiraltangfikfniyksfrankcadlcisqvvnmeel

SCOPe Domain Coordinates for d1t0fb1:

Click to download the PDB-style file with coordinates for d1t0fb1.
(The format of our PDB-style files is described here.)

Timeline for d1t0fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t0fb2