![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.16: TnsA endonuclease, N-terminal domain [53026] (1 protein) |
![]() | Protein TnsA endonuclease, N-terminal domain [53027] (1 species) a catalytic component of the tn7 transposition system |
![]() | Species Escherichia coli [TaxId:562] [53028] (2 PDB entries) Uniprot P13988 |
![]() | Domain d1t0fb2: 1t0f B:7-168 [112198] Other proteins in same PDB: d1t0fa1, d1t0fb1 complexed with the transposition protein TnsC peptide (Uniprot P05846 505-553), chains C and D protein/DNA complex; complexed with mg, mla, mpd |
PDB Entry: 1t0f (more details), 1.85 Å
SCOPe Domain Sequences for d1t0fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0fb2 c.52.1.16 (B:7-168) TnsA endonuclease, N-terminal domain {Escherichia coli [TaxId: 562]} sfsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelav flslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeq faiqvkpaaalqdertleklelerrywqqkqipwfiftdkei
Timeline for d1t0fb2: