![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.27: TnsA endonuclease, C-terminal domain [46782] (1 protein) automatically mapped to Pfam PF08721 |
![]() | Protein TnsA endonuclease, C-terminal domain [46783] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46784] (2 PDB entries) Uniprot P13988 |
![]() | Domain d1t0fa1: 1t0f A:169-268 [112195] Other proteins in same PDB: d1t0fa2, d1t0fb2 complexed with the transposition protein TnsC peptide (Uniprot P05846 505-553), chains C and D protein/DNA complex; complexed with mg, mla, mpd |
PDB Entry: 1t0f (more details), 1.85 Å
SCOPe Domain Sequences for d1t0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0fa1 a.4.5.27 (A:169-268) TnsA endonuclease, C-terminal domain {Escherichia coli [TaxId: 562]} npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt lseiraltangfikfniyksfrankcadlcisqvvnmeel
Timeline for d1t0fa1: