| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein) circularly permuted version of the "winged helix" fold |
| Protein Methionine aminopeptidase, insert domain [46888] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries) Uniprot P50579 110-478 |
| Domain d1r58a1: 1r58 A:375-448 [111695] Other proteins in same PDB: d1r58a2 complexed with ao5, mn |
PDB Entry: 1r58 (more details), 1.9 Å
SCOPe Domain Sequences for d1r58a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r58a1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc
Timeline for d1r58a1: