Lineage for d1r58a1 (1r58 A:375-448)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983357Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
    circularly permuted version of the "winged helix" fold
  6. 1983358Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 1983359Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries)
    Uniprot P50579 110-478
  8. 1983368Domain d1r58a1: 1r58 A:375-448 [111695]
    Other proteins in same PDB: d1r58a2
    complexed with ao5, mn

Details for d1r58a1

PDB Entry: 1r58 (more details), 1.9 Å

PDB Description: Crystal Structure of MetAP2 complexed with A357300
PDB Compounds: (A:) Methionine aminopeptidase 2

SCOPe Domain Sequences for d1r58a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r58a1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

SCOPe Domain Coordinates for d1r58a1:

Click to download the PDB-style file with coordinates for d1r58a1.
(The format of our PDB-style files is described here.)

Timeline for d1r58a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r58a2