Lineage for d1r58a2 (1r58 A:110-374,A:449-478)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581092Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2581093Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2581094Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2581143Protein Methionine aminopeptidase [55924] (6 species)
  7. 2581195Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries)
    Uniprot P50579 110-478
    methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
  8. 2581204Domain d1r58a2: 1r58 A:110-374,A:449-478 [111696]
    Other proteins in same PDB: d1r58a1
    complexed with ao5, mn

Details for d1r58a2

PDB Entry: 1r58 (more details), 1.9 Å

PDB Description: Crystal Structure of MetAP2 complexed with A357300
PDB Compounds: (A:) Methionine aminopeptidase 2

SCOPe Domain Sequences for d1r58a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r58a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOPe Domain Coordinates for d1r58a2:

Click to download the PDB-style file with coordinates for d1r58a2.
(The format of our PDB-style files is described here.)

Timeline for d1r58a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r58a1