SCOP 1.69: Domain d1xcbd1: 1xcb D:4-77

Lineage for d1xcbd1 (1xcb D:4-77)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)

6. Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
   AT-rich DNA-binding protein p25

7. Species Thermus aquaticus [TaxId:271] [101009] (1 PDB entry)
   CASP5

8. Domain d1xcbd1: 1xcb D:4-77 [109558]
   Other proteins in same PDB: d1xcba2, d1xcbb2, d1xcbc2, d1xcbd2, d1xcbe2, d1xcbf2, d1xcbg2

Details for d1xcbd1

PDB Entry: 1xcb, 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus

SCOP Domain Sequences for d1xcbd1:

Sequence, based on SEQRES records:

>d1xcbd1 a.4.5.38 (D:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Sequence, based on observed residues (ATOM records):

>d1xcbd1 a.4.5.38 (D:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygytvpvlk
relrhilgl

Timeline for d1xcbd1:

• d1xcbd1 is new in SCOP 1.69
  
• d1xcbd1 appears in SCOP 1.71
  
• d1xcbd1 appears in the current release, SCOPe 2.08