Lineage for d1xcbd1 (1xcb D:4-77)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
  6. Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
    AT-rich DNA-binding protein p25
  7. Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
    Uniprot Q9X2V5; # CASP5
  8. Domain d1xcbd1: 1xcb D:4-77 [109558]
    Other proteins in same PDB: d1xcba2, d1xcbb2, d1xcbc2, d1xcbd2, d1xcbe2, d1xcbf2, d1xcbg2
    protein/DNA complex; complexed with ca, nad

Details for d1xcbd1

PDB Entry: 1xcb (more details), 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus
PDB Compounds: (D:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d1xcbd1:

Sequence, based on SEQRES records: (download)

>d1xcbd1 a.4.5.38 (D:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Sequence, based on observed residues (ATOM records): (download)

>d1xcbd1 a.4.5.38 (D:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygytvpvlk
relrhilgl

SCOPe Domain Coordinates for d1xcbd1 are not available.

Timeline for d1xcbd1:

Domains from same chain:
(mouse over for more information)
d1xcbd2
Domains from other chains:
(mouse over for more information)
d1xcba1, d1xcba2, d1xcbb1, d1xcbb2, d1xcbc1, d1xcbc2, d1xcbe1, d1xcbe2, d1xcbf1, d1xcbf2, d1xcbg1, d1xcbg2